Eucgr.C02701.1.p (PRGDB228605)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228605	Eucgr.C02701.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.B02960.1.p	Eucalyptus grandis	62.5	136	2e-52
Eucgr.L01982.1.p	Eucalyptus grandis	54.5	134	1e-42
Eucgr.C02684.1.p	Eucalyptus grandis	53.3	137	3e-42
Eucgr.H02359.1.p	Eucalyptus grandis	54.4	136	7e-42
Eucgr.D01601.1.p	Eucalyptus grandis	51.8	139	3e-41
Eucgr.C03974.1.p	Eucalyptus grandis	51.5	136	6e-41
Eucgr.E01983.1.p	Eucalyptus grandis	52.9	136	2e-39
Eucgr.F03897.1.p	Eucalyptus grandis	48.1	135	2e-39
Eucgr.L02872.1.p	Eucalyptus grandis	50	136	1e-38
Eucgr.E01998.1.p	Eucalyptus grandis	55.9	136	1e-38

Showing 1 to 10 of 499 entries

Protein sequence

MYDVFLSFRGPETRYSIVDFLYKNLVRYQISVFRDDGEFNSGLGISEELELALNDSHIYIPFLSKNYASS
SWCLHELARMVKCTSKSNGKKRILPIFYDVEINDVKLESNLYRRALNEHRSLFGNKMEEWEKALRE