Eucgr.D00065.1.p (PRGDB228606)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228606	Eucgr.D00065.1.p	T	putative	TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00769.2.p	Eucalyptus grandis	66.2	157	7e-64
Eucgr.D00769.1.p	Eucalyptus grandis	66.2	157	7e-64
Eucgr.D00069.1.p	Eucalyptus grandis	58	157	4e-58
Eucgr.D01000.1.p	Eucalyptus grandis	79.8	109	1e-57
Eucgr.D00998.1.p	Eucalyptus grandis	59.9	157	3e-57
Eucgr.D00989.1.p	Eucalyptus grandis	55.1	156	2e-55
Eucgr.C01356.1.p	Eucalyptus grandis	50	152	1e-48
Eucgr.C01422.1.p	Eucalyptus grandis	50	152	2e-48
Eucgr.D01447.1.p	Eucalyptus grandis	45.1	204	9e-45
Lus10014582	Linum usitatissimum	49.3	140	3e-44

Showing 1 to 10 of 499 entries

Protein sequence

EKRRLRQCQVFIAFRGRDTRYGFAAYLYIRLVAAKIRVFYDDDTSIVGKEVGKELINAIKHCKISIPIVS
PNFASSAWCLSELNYMLSCKKEKGQKILPIFYKVNPSDVQHLSPCFEKHLHRHEAFYGRDISECWKHALK
EVGSFKGWESEKIANGYLLLSFT