Eucgr.D00998.1.p (PRGDB228609)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228609	Eucgr.D00998.1.p	T	putative	TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00069.1.p	Eucalyptus grandis	71.9	192	2e-94
Eucgr.D00989.1.p	Eucalyptus grandis	68.5	181	5e-83
Eucgr.D01450.1.p	Eucalyptus grandis	55.6	187	1e-58
Eucgr.D00769.2.p	Eucalyptus grandis	59.6	183	8e-58
Eucgr.D00769.1.p	Eucalyptus grandis	59.6	183	8e-58
Eucgr.D00065.1.p	Eucalyptus grandis	59.9	157	2e-57
Eucgr.C02111.1.p	Eucalyptus grandis	50.9	169	2e-49
Eucgr.C02112.1.p	Eucalyptus grandis	49.7	169	4e-45
Eucgr.C02108.1.p	Eucalyptus grandis	45.7	186	2e-43
Eucgr.D01447.1.p	Eucalyptus grandis	47.3	201	2e-43

Showing 1 to 10 of 499 entries

Protein sequence

HLHFLEKKRRESQYQVFLAFRGPDTRHSLAAYLYISLVAAGIRVFNDADPSLIGKDVDHEICNAIDHCKI
SIPILSEDYPSSHWCLDELAQMVECKRTKRQKILPIFYKVRTSHVRDLLGVFGEKMLKHEKIVDECTYER
WKLALKEVGSFKGWVSERIANGHEGVLVKEVVKEVSRLLKNTQAHEPHHYMPN