Eucgr.B02967.1.p (PRGDB228613)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228613	Eucgr.B02967.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H02362.1.p	Eucalyptus grandis	57.9	121	2e-41
Eucgr.L01982.1.p	Eucalyptus grandis	52.5	120	4e-41
Eucgr.K01937.1.p	Eucalyptus grandis	59.5	116	1e-40
Eucgr.H02359.1.p	Eucalyptus grandis	55.4	121	2e-40
Eucgr.C02718.1.p	Eucalyptus grandis	52.5	120	4e-38
Eucgr.F02533.1.p	Eucalyptus grandis	54.2	118	5e-38
Eucgr.F03914.1.p	Eucalyptus grandis	52.5	120	6e-38
Eucgr.F03913.1.p	Eucalyptus grandis	52.5	122	7e-38
Eucgr.F03897.1.p	Eucalyptus grandis	50.4	123	9e-37
Eucgr.C02558.1.p	Eucalyptus grandis	48.4	126	1e-36

Showing 1 to 10 of 499 entries

Protein sequence

MKGTGVRVFRDNDEIQVGQNIKDELWHAIESSKIYMPVFSKTYASSKWCLKELAKMMEVTSRSNGTKEIL
PIFFDVSPGDVKLKTSLYKNELSNHAKMYEADKVKAWEKALVEVGKLKGWKPGNVG