Eucgr.L00496.1.p (PRGDB228615)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228615	Eucgr.L00496.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.L00490.1.p	Eucalyptus grandis	74.4	168	2e-79
Eucgr.L01982.1.p	Eucalyptus grandis	53.3	150	1e-55
Eucgr.F03897.1.p	Eucalyptus grandis	52.8	161	3e-53
Eucgr.C03974.1.p	Eucalyptus grandis	58.2	146	3e-52
Eucgr.K01937.1.p	Eucalyptus grandis	56.4	149	1e-51
Eucgr.L02872.1.p	Eucalyptus grandis	54.9	164	5e-51
Eucgr.F03913.1.p	Eucalyptus grandis	52.1	169	6e-51
Eucgr.C01970.1.p	Eucalyptus grandis	52.2	157	8e-51
Eucgr.D01601.1.p	Eucalyptus grandis	50.9	167	2e-50
Eucgr.F03914.1.p	Eucalyptus grandis	49.4	168	2e-50

Showing 1 to 10 of 499 entries

Protein sequence

MDKEKSSEAGTSGGELSTIDYEVFLSFRGPDTRQGFTDCLYHEMQEANIRVFFDEEELHVGKEIADELPM
AIEKSKIYVPIFSKGYVSSPWCLRELAHMVECTNTKPSEKEIMPIFYNVKPRDVRLMSPLYVHDLKEHEK
KFGCQTRLKWEDALKSVAKIKGWELKSQ