Eucgr.H02184.1.p (PRGDB228672)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228672	Eucgr.H02184.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H02176.1.p	Eucalyptus grandis	93.4	196	2e-132
Eucgr.H02148.1.p	Eucalyptus grandis	94.2	174	2e-119
Eucgr.H01809.1.p	Eucalyptus grandis	91	156	8e-102
Eucgr.H02155.1.p	Eucalyptus grandis	90.7	150	7e-98
Eucgr.H01749.1.p	Eucalyptus grandis	80	175	4e-94
Eucgr.H01785.1.p	Eucalyptus grandis	83.1	160	3e-92
Eucgr.L02373.1.p	Eucalyptus grandis	83.8	160	3e-89
Eucgr.H02032.1.p	Eucalyptus grandis	75.6	160	6e-84
Eucgr.H01903.1.p	Eucalyptus grandis	75.8	157	2e-82
Eucgr.H02116.1.p	Eucalyptus grandis	74.7	158	3e-82

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSSKRRRSYDVFLSFRGMDARNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEAIEESQIA
IVVFSKDFASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAEAMAKHEVKFGEDSEKVK
RWKKALLDAGSLSGWHFMDGGIGHIHTKAGACGMLPAHFNIYKRTRTKMSCLRLYI