Eucgr.H02155.1.p (PRGDB228678)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228678	Eucgr.H02155.1.p	T	putative	TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H01809.1.p	Eucalyptus grandis	88.5	165	6e-105
Eucgr.H02176.1.p	Eucalyptus grandis	88.1	160	6e-101
Eucgr.H01785.1.p	Eucalyptus grandis	84.8	165	1e-98
Eucgr.H02184.1.p	Eucalyptus grandis	90.7	150	2e-98
Eucgr.H02148.1.p	Eucalyptus grandis	89	155	2e-98
Eucgr.H01749.1.p	Eucalyptus grandis	85.9	156	6e-92
Eucgr.L02373.1.p	Eucalyptus grandis	78.2	165	4e-85
Eucgr.H02116.1.p	Eucalyptus grandis	75.7	173	7e-83
Eucgr.H02032.1.p	Eucalyptus grandis	72.7	165	5e-82
Eucgr.H01903.1.p	Eucalyptus grandis	73.2	157	7e-79

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSSSSKRRRSHDVFLSFRGMDVRNYFLSHLYTALVQSGINTYMDSEDLKKGEQISPALMEAIEDSQ
IAIVVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAEAMAEHEVKFGKDSEK
VKRWKKALLDVGSLSGLHFINGYVKTLLLLQLVQFF