Eucgr.L03010.1.p (PRGDB228862)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228862	Eucgr.L03010.1.p	L	putative	LRR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00746.1.p	Eucalyptus grandis	80.8	130	1e-56
Eucgr.C01957.1.p	Eucalyptus grandis	78.1	137	9e-56
Eucgr.C01654.1.p	Eucalyptus grandis	77.4	133	7e-54
Eucgr.L03006.1.p	Eucalyptus grandis	75.4	134	2e-53
Eucgr.C01973.1.p	Eucalyptus grandis	75.8	132	1e-52
Eucgr.C01662.1.p	Eucalyptus grandis	74.5	137	2e-52
Eucgr.D00724.1.p	Eucalyptus grandis	73.2	123	1e-50
Eucgr.C01649.1.p	Eucalyptus grandis	68.5	127	2e-44
Eucgr.G02264.1.p	Eucalyptus grandis	63.2	125	4e-39
Eucgr.C01968.1.p	Eucalyptus grandis	71.4	105	1e-35

Showing 1 to 10 of 371 entries

Protein sequence

MLKEILEASAFLSLEKLIPNGCEMLTKLSDSIGMLKYLVELDVSFTSIVELPNSIVNLKSLKVLKIDRSR
MQKLPYAIVMMEKLEEIYGEYYGKLEVISSDIVRMAFLQILKLIGTCVENVPKLPQSLVSPYLSSHV