Eucgr.D00724.1.p (PRGDB228888)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228888	Eucgr.D00724.1.p	L	putative	LRR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.L03010.1.p	Eucalyptus grandis	73.2	123	1e-50
Eucgr.D00746.1.p	Eucalyptus grandis	82.9	105	1e-47
Eucgr.C01654.1.p	Eucalyptus grandis	84	106	6e-46
Eucgr.L03006.1.p	Eucalyptus grandis	80.6	103	2e-44
Eucgr.C01957.1.p	Eucalyptus grandis	79	105	7e-44
Eucgr.C01662.1.p	Eucalyptus grandis	78.1	105	2e-43
Eucgr.C01973.1.p	Eucalyptus grandis	77.1	105	9e-43
Eucgr.G02264.1.p	Eucalyptus grandis	61.7	107	6e-33
Eucgr.C01649.1.p	Eucalyptus grandis	65.6	96	7e-31
Eucgr.C01968.1.p	Eucalyptus grandis	67.8	87	9e-27

Showing 1 to 10 of 499 entries

Protein sequence

MLKEIFEPSTFLSLEKLILNGCQMLTKLSDSIGMLKYLIELDVSFTSIVELPNSIVNLKSLKVLKIGGSR
MQKLPYTIGMMEKIWKIYGEDCVKLEVIPSDIVRLTIFADFEINRNLCGECTKVSIEFGKSISIFKSYSM
PLG