Thhalv10002357m (PRGDB233154)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB233154	Thhalv10002357m	T	putative	TIR	Eutrema salsugineum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thhalv10026964m	Eutrema salsugineum	56.1	132	4e-38
Bostr.20129s0395.1.p	Babiana stricta	43.2	132	5e-27
Bostr.20129s0395.2.p	Babiana stricta	43.2	132	5e-27
Thhalv10024348m	Eutrema salsugineum	45	131	7e-27
Araha.21478s0010.1.p	Arabidopsis halleri	43.5	131	4e-26
895867	Arabidopsis lyrata	56.5	69	3e-18
MDP0000194077	Malus domestica	40.4	94	2e-15
MDP0000287865	Malus domestica	40.4	94	3e-15
Cagra.1361s0071.1.p	Conradina grandiflora	36.8	125	3e-14
MDP0000215060	Malus domestica	44.4	72	3e-13

Showing 1 to 10 of 499 entries

Protein sequence

MAASLTTEAENSSSRSLWEYDVFLSFRGKDVQKSLMSHLNDVFNEEGIKTFHEDRDLQREKKQLKWIPIF
YEIDSSNLKSRTGCFSKALRSMS