evm_27.model.AmTr_v1.0_scaffold00060.158 (PRGDB23946)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB23946	evm_27.model.AmTr_v1.0_scaffold00060.158	T	putative	TM, TIR	Amborella trichopoda

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
evm_27.model.AmTr_v1.0_scaffold00010.351	Amborella trichopoda	91.7	96	1e-51
evm_27.model.AmTr_v1.0_scaffold00010.353	Amborella trichopoda	85.4	96	5e-50
Araha.47829s0001.1.p	Arabidopsis halleri	43.4	76	8e-14
Eucgr.H02176.1.p	Eucalyptus grandis	38.2	76	4e-13
Bostr.10273s0067.1.p	Babiana stricta	39.5	81	5e-13
mrna26575.1-v1.0-hybrid	Fragaria vesca	40	80	7e-13
MDP0000219893	Malus domestica	41.6	77	8e-13
Eucgr.H02148.1.p	Eucalyptus grandis	38.2	76	8e-13
Bostr.2021s0026.1.p	Babiana stricta	40.8	76	8e-13
Eucgr.H02184.1.p	Eucalyptus grandis	39.5	76	9e-13

Showing 1 to 10 of 499 entries

Protein sequence

MDEVLVSEDVRGRVILYDAFISHRGSELKKHAEKIHGDLSGLGVSSFFDSREIRTGENLSGVIVEAIRVS
SIWLVLLSKGFAESPWCLDEVRLMVD