Kalax.0357s0019.2.p (PRGDB250142)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB250142	Kalax.0357s0019.2.p	N	putative	NBS	Kalanchoe marnieriana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Kalax.0447s0011.1.p	Kalanchoe marnieriana	99.9	173	4e-126
Kalax.0357s0019.1.p	Kalanchoe marnieriana	99.9	173	5e-126
VIT_08s0007g07370.t01	Vitis vinifera	91.9	173	2e-117
Prupe.7G004400.2.p	Prunus persica	93.1	173	2e-116
Prupe.7G004400.1.p	Prunus persica	93.1	173	2e-116
Manes.09G141100.1.p	Manihot esculenta	91.3	173	1e-115
29950.m001128	Ricinus communis	89.6	173	8e-115
Thecc1EG026470t1	Theobroma cacao	89.6	173	3e-113
Araha.51494s0003.1.p	Arabidopsis halleri	88.4	173	7e-112
896410	Arabidopsis lyrata	88.4	173	1e-111

Showing 1 to 10 of 365 entries

Protein sequence

MSTVGNSTNIFWQECPVGKNERQKLLNQKGCVVWITGLSGSGKSTLACSLGRELHSKGKLSYILDGDNLR
HGLNKDLGFKAEDRTENIRRVGEVAKLFSDAGLICIASLISPYRKDRDACRAMLTDSTFIEVFMNMPLEV
CEKRDAKGLYKLARAGKIKGFTGIDDPYEPPLHY