MDP0000309222 (PRGDB258270)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258270	MDP0000309222	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000675405	Malus domestica	85.7	49	7e-20
MDP0000478441	Malus domestica	85.7	49	8e-20
MDP0000414895	Malus domestica	70.8	48	5e-14
MDP0000723101	Malus domestica	72.9	48	7e-14
MDP0000902193	Malus domestica	72.9	48	1e-13
MDP0000542613	Malus domestica	70.8	48	2e-13
MDP0000404539	Malus domestica	64.6	48	8e-13
MDP0000793744	Malus domestica	68.1	47	1e-12
MDP0000769222	Malus domestica	63.8	47	1e-12
MDP0000602346	Malus domestica	68.8	48	2e-12

Showing 1 to 10 of 57 entries

Protein sequence

MFQKHEENIRKEDDDKKGEAKRESVEQWRKALAEAANLSGYDLKNTENGSGRTRLGWSSRAALWNRREQQ
QSRGIIQLRRRKHKPNIPETNFSDDSSTTVDYDNNYYDPHFD