MDP0000404539 (PRGDB258271)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258271	MDP0000404539	CT	putative	CC, TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000754312	Malus domestica	97.5	81	1e-48
MDP0000902193	Malus domestica	91.4	81	3e-46
MDP0000608722	Malus domestica	88.9	81	4e-44
MDP0000602346	Malus domestica	90.1	81	4e-44
MDP0000509532	Malus domestica	87.7	81	3e-43
MDP0000494647	Malus domestica	87.7	81	9e-43
MDP0000723101	Malus domestica	87.7	81	1e-42
MDP0000414895	Malus domestica	84	81	9e-42
MDP0000542613	Malus domestica	82.7	81	3e-39
MDP0000440952	Malus domestica	78.5	79	3e-39

Showing 1 to 10 of 499 entries

Protein sequence

MECRYKPGRHVLPIFYHVDPSHVRKQNEDLAQAFQKHEEGIREEKDDKERETRQERVKQWRKALTEAANL
SGQHLQITDKG