MDP0000440952 (PRGDB258356)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258356	MDP0000440952	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000504579	Malus domestica	89.8	127	3e-76
MDP0000536130	Malus domestica	82	128	2e-73
MDP0000542613	Malus domestica	89	127	6e-72
MDP0000458576	Malus domestica	89.8	127	8e-72
MDP0000640736	Malus domestica	87.4	127	1e-70
MDP0000902193	Malus domestica	84.2	127	1e-69
MDP0000797088	Malus domestica	78.9	128	4e-69
MDP0000622549	Malus domestica	86.6	127	1e-68
MDP0000414895	Malus domestica	81.9	127	2e-68
MDP0000723101	Malus domestica	84.2	127	2e-66

Showing 1 to 10 of 499 entries

Protein sequence

MDEDDLKRGEEIKEELFRAIEGSRISIIVFSKRYADSSWCLDELVKIMECRSKLGRHVLPIFYHVDPSHV
RKQNGDLVKAFQKHNKGISKVKDGKKREAERERVKQWRKALTEVANLSGHHLQITDNR