MDP0000253180 (PRGDB258278)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258278	MDP0000253180	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000827008	Malus domestica	84	106	8e-58
MDP0000463259	Malus domestica	74.5	106	9e-47
MDP0000749555	Malus domestica	66.9	127	3e-42
MDP0000737010	Malus domestica	64.6	127	2e-41
MDP0000704959	Malus domestica	56.9	137	4e-41
MDP0000498615	Malus domestica	67.3	107	2e-40
MDP0000948085	Malus domestica	67.3	107	3e-40
MDP0000586712	Malus domestica	69.2	107	4e-40
MDP0000679401	Malus domestica	62.3	114	5e-40
MDP0000652722	Malus domestica	59.8	122	2e-39

Showing 1 to 10 of 499 entries

Protein sequence

MTTPFIMTTTCPHVVVISSSSQSSNHWKYEVFLSLGDDTRTTFIDHISIALCDAGINTFVDYQLRREENI
QSELDGEFEGSRINLVIFSKRYAESGCYLSKPSKIMRCREDQEVKVVYPIFYDVHSSQNRVVVLEKHFRS
MKRMTVRKRVVIKDGAVMQDEHEDTV