MDP0000569556 (PRGDB258282)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258282	MDP0000569556	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000685661	Malus domestica	98.4	125	1e-89
MDP0000376416	Malus domestica	88	125	8e-69
MDP0000749555	Malus domestica	71.2	125	4e-53
MDP0000737010	Malus domestica	71.2	125	1e-50
MDP0000484463	Malus domestica	72	125	6e-50
MDP0000498615	Malus domestica	69.6	125	2e-46
MDP0000948085	Malus domestica	69.6	125	3e-46
MDP0000704959	Malus domestica	62.5	120	5e-46
MDP0000740574	Malus domestica	72	125	2e-45
MDP0000679401	Malus domestica	61.6	125	4e-45

Showing 1 to 10 of 499 entries

Protein sequence

MDTISSANGTAFAAFSSSLCHSNRWKYEVFLSFRGDDTCTTFTDHLSIAVHNAGIHMLIDYQLRRGENIQ
SELDQEIKGPSSVFSKRYTKSGWCLRELAKIMRCQEDQKGKVVHPILYDVDPLRK