MDP0000289761 (PRGDB258289)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258289	MDP0000289761	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000317951	Malus domestica	98.1	158	3e-107
MDP0000706467	Malus domestica	98.7	158	4e-103
MDP0000479325	Malus domestica	94.5	146	4e-90
MDP0000695029	Malus domestica	97.7	133	7e-85
MDP0000651853	Malus domestica	72.9	155	3e-75
MDP0000140578	Malus domestica	71	155	3e-66
MDP0000637728	Malus domestica	62.5	152	2e-61
MDP0000249335	Malus domestica	63.5	148	8e-60
MDP0000827937	Malus domestica	56.5	154	1e-54
MDP0000735861	Malus domestica	52.6	173	7e-53

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSSSKCSKYDVFLSFRGETRKSLTDNLYCTLKDHRFNVFIDENELTRGEIITPALKQAVKDSRLAA
IIFSSGYAESRWCLDELVEILASRRTMGQMVLPIFYNIDPSDVRHQRGAFAEAFRRHQECFPKMVQTWKD
ALXEAAELAGEDFSVTDG