MDP0000294696 (PRGDB258314)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258314	MDP0000294696	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000487979	Malus domestica	95	120	1e-76
MDP0000661138	Malus domestica	98.2	112	5e-74
MDP0000601632	Malus domestica	87.5	112	9e-66
MDP0000946278	Malus domestica	87.5	112	9e-66
MDP0000173893	Malus domestica	90.2	112	3e-61
MDP0000605598	Malus domestica	82.1	112	4e-59
MDP0000573414	Malus domestica	77.8	117	4e-59
MDP0000314565	Malus domestica	84.3	108	5e-58
MDP0000168302	Malus domestica	99	97	4e-57
Prupe.2G127000.4.p	Prunus persica	81.4	113	2e-54

Showing 1 to 10 of 499 entries

Protein sequence

VLRFSADKRCRYFLTANVDCESCRLHLTQKKGRDILVVRNIIAYDWKWGIIVGRDLSVCPKQXMAKILEK
TFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIQQSRTSVVVFSKDYASSRWCLDELVLILERKR
TTSDHVVLPVFYDVDPSHVRKQTGSVGKAFARSQKNQSSEK