MDP0000605598 (PRGDB258335)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258335	MDP0000605598	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000601632	Malus domestica	79.9	139	2e-73
MDP0000946278	Malus domestica	79.9	139	2e-73
MDP0000661138	Malus domestica	79.9	139	6e-72
MDP0000314565	Malus domestica	79.3	140	6e-68
MDP0000173893	Malus domestica	79.1	139	6e-62
Prupe.2G126100.1.p	Prunus persica	72.1	140	1e-59
MDP0000294696	Malus domestica	82.1	112	4e-59
Prupe.2G127000.4.p	Prunus persica	71.9	139	1e-58
MDP0000487979	Malus domestica	81.4	113	2e-58
MDP0000610616	Malus domestica	68.8	138	3e-58

Showing 1 to 10 of 499 entries

Protein sequence

MGHFFTPRNHPXFDPAIYSSSEFRLGDLGTDGLGIRRTSSDSNTSRGCCYDEFLIFRGEDTRKTFTDHLY
TTLNNTGFLTFRDDDELERGEDIKSELQKAIQLSRTSVVMFLKDYASSKWCLDELVVILECKRTTSDHVV
LPVFYDVDPSYMRKQTGSIEKTFARNEKTQLSGKVKR