MDP0000651595 (PRGDB258321)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258321	MDP0000651595	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000754718	Malus domestica	93.4	76	5e-35
MDP0000688456	Malus domestica	84.2	76	5e-33
MDP0000797088	Malus domestica	84.2	76	1e-32
MDP0000685087	Malus domestica	86.8	76	2e-31
MDP0000505414	Malus domestica	93.4	76	3e-31
MDP0000848588	Malus domestica	69.7	76	5e-31
MDP0000527962	Malus domestica	80.3	76	6e-31
MDP0000468314	Malus domestica	84.2	76	1e-30
MDP0000769222	Malus domestica	82.9	76	2e-30
MDP0000504579	Malus domestica	73.3	75	2e-30

Showing 1 to 10 of 499 entries

Protein sequence

MTAHEASSSCSSKSELWSYDVFLSFSGEDTRNGFTSHLHEALKYRGYHVFIDEDGLKRGEEIKEKLFRAI
EESRISYHCLLKDVCGFELVS