MDP0000837375 (PRGDB258352)

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258352	MDP0000837375	T	putative	TM, TIR	Malus domestica

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000481803	Malus domestica	95.6	68	6e-39
MDP0000753149	Malus domestica	80	70	5e-35
MDP0000376721	Malus domestica	80	70	4e-33
MDP0000668433	Malus domestica	81.7	71	8e-33
MDP0000399716	Malus domestica	80.3	71	2e-32
MDP0000540495	Malus domestica	68.3	82	1e-31
MDP0000125643	Malus domestica	77.5	71	3e-30
MDP0000580157	Malus domestica	72.7	77	5e-30
MDP0000525273	Malus domestica	70.4	81	6e-30
MDP0000410502	Malus domestica	79.7	69	4e-29

Showing 1 to 10 of 499 entries

MAAASSCSSSSSDCSWKYDVFLNFRGEDTRKVFIGHLYRALNQKAINTFIDGEELREGNDLSELLTAIAD
SRLSIVVFSENYASSVSVCVCSFSMCFNGGCLQRWKEFPREEAAKCLFEFHSHILHNTILPLYEEGKGDP
SLFNI