MDP0000536130 (PRGDB258363)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258363	MDP0000536130	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000440952	Malus domestica	82	128	2e-73
MDP0000797088	Malus domestica	79.7	128	3e-70
MDP0000542613	Malus domestica	84.2	127	1e-68
MDP0000902193	Malus domestica	81.1	127	1e-68
MDP0000414895	Malus domestica	78.7	127	5e-67
MDP0000640736	Malus domestica	82.7	127	2e-66
MDP0000723534	Malus domestica	80.5	128	6e-66
MDP0000723101	Malus domestica	81.1	127	2e-65
MDP0000717656	Malus domestica	78.1	128	2e-65
MDP0000685087	Malus domestica	78.7	127	9e-65

Showing 1 to 10 of 499 entries

Protein sequence

MDEDDLKRGEEIKEELFRAIEESRVSIIVFSKRYADSSWCFDELVKIIECRSKRGRHVFPIFYHVDPSHV
RKQNGDLAEVFKKHEKGIDEEKDDKKHESKKERVKQWREALTKAADLSGHHLQITDNR