MDP0000192278 (PRGDB258371)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258371	MDP0000192278	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000194082	Malus domestica	98.4	128	3e-87
MDP0000190522	Malus domestica	73.9	134	2e-62
MDP0000309329	Malus domestica	73.8	130	8e-57
MDP0000222184	Malus domestica	75.8	128	1e-56
MDP0000190736	Malus domestica	73.4	128	4e-55
MDP0000689477	Malus domestica	73.1	119	4e-53
MDP0000177288	Malus domestica	77.2	92	6e-44
Prupe.8G110600.1.p	Prunus persica	63.3	128	3e-43
MDP0000287354	Malus domestica	68.6	102	4e-41
Prupe.1G162500.1.p	Prunus persica	65.7	108	2e-40

Showing 1 to 10 of 499 entries

Protein sequence

MDSTTSEGASSFSSSSTSFTHPSSSSTSFTHPWRYDVFLSFRGEDTRYHFVGHLYNYLVQMGIKTFMDEK
SLKRGEEISLALLKAIEDSRISLVVFSENYASSRWCLDELVHIFHCKEQQQQMVFQSFSRWIHRK