MDP0000190522 (PRGDB258382)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258382	MDP0000190522	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000190736	Malus domestica	88.8	116	3e-65
MDP0000309329	Malus domestica	87.3	118	3e-64
MDP0000222184	Malus domestica	87.9	116	1e-63
MDP0000689477	Malus domestica	85.7	112	3e-60
MDP0000192278	Malus domestica	72.4	134	2e-58
MDP0000194082	Malus domestica	72.3	130	1e-54
Prupe.8G110600.1.p	Prunus persica	73.3	116	5e-49
MDP0000177288	Malus domestica	81.5	92	1e-46
Prupe.8G109900.1.p	Prunus persica	65	117	3e-44
mrna32631.1-v1.0-hybrid	Fragaria vesca	61.5	117	3e-44

Showing 1 to 10 of 499 entries

Protein sequence

MDSTTNEGASSSSSFTHSWTYDVFLNFRGEDTRYNFVGHLYYNLVQKGIKTFIDDEALKRGEEISLALLK
AIEQSRISLVVFSENYASSXWCLDELIHIFHCKEQLQQMVXPVFTRWIHRM