Medtr2g012920.1 (PRGDB266638)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB266638	Medtr2g012920.1	T	putative	TIR	Medicago truncatula

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.13G243000.1.p	Glycine max	70.4	162	9e-81
Glyma.15G070400.1.p	Glycine max	69.9	163	1e-78
Glyma.07G193000.1.p	Glycine max	68.9	164	1e-76
Phvul.006G188800.1	Phaseolus vulgaris	66.3	163	3e-75
Medtr4g089115.1	Medicago truncatula	67.9	159	7e-75
Thecc1EG029929t1	Theobroma cacao	62.5	160	7e-70
Gorai.009G170500.1	Gossypium raimondii	61	164	1e-66
Manes.16G024000.1.p	Manihot esculenta	58.8	160	2e-65
Potri.004G038200.1	Populus trichocarpa	60.6	160	2e-65
MDP0000178596	Malus domestica	60.1	158	2e-64

Showing 1 to 10 of 499 entries

Protein sequence

MQHFYRKIIQPTCQVFINHRGIDTKKNVAGLLYKDLTSMGVRSFLDCKNMKLGDKLSPNIDKAIFDCKVG
VVVFSPNYCDSYYCLHELALLMETKKRAVPILFDVELSQLMVKDDGTRSQEQLLRYNLALQEAKDTVALP
FDSLNGDWSELLRKAADAVIMNLMEADHE