76642 (PRGDB270561)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270561	76642	L	putative	LRR	Micromonas

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Mapoly0120s0022.1.p	Marchantia polymorpha	38.4	99	7e-12
17120	Coccomyxa subellipsoidea	45.7	94	2e-11
Dusal.0788s00005.1.p	Dunaliella salina	42	100	2e-10
Cre02.g092850.t1.2	Chlamydomonas reinhardtii	35.4	99	2e-10
Mapoly0051s0012.1.p	Marchantia polymorpha	32.8	119	3e-10
CMM185CT	Cyanidioschyzon merolae	45.2	93	5e-10
Pp3c19_6520V3.1.p	Physcomitrella patens	39.4	94	7e-10
Pp3c19_6520V3.2.p	Physcomitrella patens	39.4	94	7e-10
AHYPO_005495-RA	Amaranthus hypochondriacus	37.4	91	1e-9
mrna28663.1-v1.0-hybrid	Fragaria vesca	37.4	91	1e-9

Showing 1 to 10 of 228 entries

Protein sequence

LETVRNLVFLDLYANAVEKIAGLECVPQLRVLMLGRNRIRSIGAGLARLQRLDVLDLHNNEIASTSGLNS
LASLRILNLAGNRLVSLGDLGNMTGLHEL