74959 (PRGDB270578)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270578	74959	L	putative	LRR	Micromonas

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
82436	Micromonas	80.8	78	1e-33
99220	Micromonas	70.5	78	1e-29
55526	Micromonas	74.4	78	1e-29
88873	Micromonas	76.9	78	5e-29
89195	Micromonas	70.5	78	7e-28
84219	Micromonas	75.6	78	1e-27
79944	Micromonas	70.5	78	2e-27
81822	Micromonas	66.7	78	2e-27
78713	Micromonas	71.4	77	3e-27
55529	Micromonas	73.1	78	5e-27

Showing 1 to 10 of 499 entries

Protein sequence

AVPAEVWRLSAMRKLSLPKNQLTCVPAEIGQLTSLEGLWLHANQLTSVPAEIGQLTSLTYLHLSSNQLTS
VPAAIREL