74345 (PRGDB270618)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270618	74345	RLP	putative	LRR, TM	Micromonas

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
158715	Micromonas pusilla	63	108	7e-42
84219	Micromonas	46.3	108	3e-23
89134	Micromonas	44.4	108	1e-22
83010	Micromonas	46.3	108	2e-22
77808	Micromonas	51	98	4e-22
ConsensusfromContig56187-snap_masked-ConsensusfromContig56187-abinit-gene-0.0-mRNA-1:cds:11739/553-673:0:+	Cyanophora paradoxa	41.7	108	6e-22
62214	Micromonas	46.3	108	8e-22
83283	Micromonas	45.4	108	2e-21
88873	Micromonas	45.4	108	3e-21
101709	Micromonas	45.4	108	3e-21

Showing 1 to 10 of 499 entries

Protein sequence

EIAGFDHLQVLALDGNDITGIPAAIGALASMEQCYLSNNSLESVPPELGDCVSLETLWLNGNQLTSIPKE
LANLVALETLDLSDNLLETLPSELANLDLLEQLDIYNN