158715 (PRGDB270995)

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB270995	158715	L	putative	LRR	Micromonas pusilla

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
74345	Micromonas	63	108	9e-42
84219	Micromonas	50	130	1e-29
88873	Micromonas	52	125	1e-27
78713	Micromonas	45.2	135	3e-27
62214	Micromonas	55.6	108	4e-27
81826	Micromonas	50.8	120	1e-26
107462	Micromonas	50.4	135	1e-26
83283	Micromonas	48.9	131	1e-26
77808	Micromonas	50.8	128	1e-26
71867	Micromonas	50.4	125	2e-26

Showing 1 to 10 of 499 entries

EIGGLSELRSLALDGNELTGVPSSIGNLTKLEELYLSNNNLRSVPPEIGNCVNLVTLWLNNNELTSVPAE
LGNLLALEMLDVSENDLTTLPAEIGDLELLEQLDIYGNSEKMRLPASLQEDEKLEESGCNIVREDPEE