Migut.M01171.1.p (PRGDB271002)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB271002	Migut.M01171.1.p	T	putative	TM, TIR	Erythranthe guttata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Thecc1EG029929t1	Theobroma cacao	65	186	1e-86
Solyc02g078680.1.1	Solanum lycopersicum	65.8	190	6e-84
orange1.1g046164m	Citrus sinensis	63.7	190	2e-81
VIT_00s0375g00020.t01	Vitis vinifera	63.4	186	5e-81
Gorai.009G170500.1	Gossypium raimondii	64.5	186	5e-81
Ciclev10018304m	Citrus clementina	63.7	190	1e-80
Potri.004G038200.1	Populus trichocarpa	62.4	186	2e-80
Manes.17G042000.1.p	Manihot esculenta	70.9	158	5e-80
Prupe.4G041100.1.p	Prunus persica	62.6	187	2e-79
Manes.16G024000.1.p	Manihot esculenta	62.2	193	2e-79

Showing 1 to 10 of 499 entries

Protein sequence

MQRASSVVANTVCRQILRKHQLAAAPAPRPCDVFINHRGVDTKRNVAGLLYHDLLGIGIRPFLDSKSMKP
GDKLFDKIDVAIRECKVGVAVFSPMYCDSYFCLHELALMVESKKKVVPIFCDVKPSELRVKTGDGSRSPE
DLERFRSALEEAKLTVGLTFDTLTGDWPEFLANATDVVIKNLIEVEE