Araha.66955s0001.1.p (PRGDB28341)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28341	Araha.66955s0001.1.p	T	putative	TIR	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT4G11170.1	Arabidopsis thaliana	89.6	154	8e-93
Cagra.4011s0004.1.p	Conradina grandiflora	89	154	1e-88
Thhalv10023232m	Eutrema salsugineum	84.1	151	8e-82
AT5G49140.1	Arabidopsis thaliana	73.8	145	3e-67
Bostr.10040s0223.1.p	Babiana stricta	67.8	143	9e-65
Araha.59926s0001.1.p	Arabidopsis halleri	65.5	142	2e-63
Cagra.0569s0023.1.p	Conradina grandiflora	64.1	156	2e-63
Bostr.5024s0001.1.p	Babiana stricta	63.2	152	4e-63
Bostr.7200s0103.1.p	Babiana stricta	66	141	5e-63
Bo9g064380.1	Brassica oleracea	61.6	151	8e-63

Showing 1 to 10 of 499 entries

Protein sequence

MAFSSSNSWRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIERSQTIGPELVAAIRESKISVVL
FSENYASSSWCLDELVEILKCKEERGQKVMPVFYKVDPSDVRKQTGKFGMSFLKTCCGKMEEQQHNWRQA
LTDAANIVGDHPQD