ONIVA02G12380.1 (PRGDB290690)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB290690	ONIVA02G12380.1	L	putative	LRR	Oryza nivara

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
OBART03G27390.1	Oryza barthii	99.9	85	2e-54
ORGLA03G0255700.1	Oryza glaberrima	99.9	85	2e-54
ORUFI03G28530.1	Oryza rufipogon	98.8	85	2e-53
LOC_Os03g44260.1	Oryza sativa	98.8	85	2e-53
BGIOSGA013208-PA	Oryza sativa Indica Group	98.8	84	8e-53
MLOC_53949.2	Hordeum vulgare	90.4	83	2e-47
Traes_5BL_AE4D58934.1	Triticum aestivum	90.4	83	3e-47
Bradi1g13793.1.p	Brachypodium distachyon	87.7	81	2e-45
Pavir.J40787.1.p	Panicum virgatum	89.2	83	1e-44
Brast02G244800.1.p	Brachypodium stacei	86.4	81	2e-44

Showing 1 to 10 of 57 entries

Protein sequence

MADLLGDPTWPQLHPRPCTDTPWPGLQCELAPDDARHLRATRLHFGPDVATPPCRPGARLAAPVLLGLPH
LKTLSLFGCFVVADC