ORUFI03G28530.1 (PRGDB295924)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB295924	ORUFI03G28530.1	L	putative	LRR	Oryza rufipogon

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
LOC_Os03g44260.1	Oryza sativa	99.9	85	2e-54
BGIOSGA013208-PA	Oryza sativa Indica Group	99.9	84	4e-54
ORGLA03G0255700.1	Oryza glaberrima	98.8	85	2e-53
OBART03G27390.1	Oryza barthii	98.8	85	2e-53
ONIVA02G12380.1	Oryza nivara	98.8	85	2e-53
MLOC_53949.2	Hordeum vulgare	89.2	83	4e-46
Traes_5BL_AE4D58934.1	Triticum aestivum	89.2	83	4e-46
Bradi1g13793.1.p	Brachypodium distachyon	86.4	81	4e-44
Pavir.J40787.1.p	Panicum virgatum	88	83	2e-43
Brast02G244800.1.p	Brachypodium stacei	85.2	81	3e-43

Showing 1 to 10 of 52 entries

Protein sequence

MADLLGDPTWPQLHRRPCTDTPWPGLQCELAPDDARHLRATRLHFGPDVATPPCRPGARLAAPVLLGLPH
LKTLSLFGCFVVADC