MDP0000224185 (PRGDB258899)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258899	MDP0000224185	RLP	putative	LRR, TM	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000200861	Malus domestica	99	207	2e-143
MDP0000174573	Malus domestica	86	185	4e-97
MDP0000219444	Malus domestica	86	185	6e-96
MDP0000609416	Malus domestica	81.1	185	4e-88
MDP0000672245	Malus domestica	82.2	185	2e-85
MDP0000703418	Malus domestica	71	186	4e-77
MDP0000206973	Malus domestica	63.8	185	1e-66
MDP0000194422	Malus domestica	84.4	128	2e-62
Prupe.2G116200.7.p	Prunus persica	60.4	182	5e-61
Prupe.2G116200.2.p	Prunus persica	60.4	182	8e-61

Showing 1 to 10 of 499 entries

Protein sequence

MGNNSLSGNVPSSFGNLSRLTDLHLKDNNHQGTIPSTLSQCXNFVNLTLGGNNFTGIISPXLIHLSSSYV
HLDLSRNHLTSCLPIEVGQLINLEHFDVSGNLLSGEIPPSLGSCKTTRYLYLQENFFQGTIPSNLRSLRG
IETLSLTCNNLLGTIPKFLENFTFLQSLNLYYNNLEEAVPIEGVFLECNWHISTRECKALWGHTKIL