Pp3s203_50V3.1.p (PRGDB2110120)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110120	Pp3s203_50V3.1.p	N	putative	NBS	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c17_18950V3.1.p	Physcomitrella patens	87.9	66	2e-34
Pp3c17_18950V3.2.p	Physcomitrella patens	87.9	66	2e-34
Pp3c13_19900V3.1.p	Physcomitrella patens	74.2	66	6e-26
Pp3c21_6260V3.1.p	Physcomitrella patens	66.7	66	1e-23
Pp3c18_4570V3.1.p	Physcomitrella patens	86.8	53	3e-22
Pp3c18_4530V3.1.p	Physcomitrella patens	65.2	66	5e-22
Pp3c18_4530V3.2.p	Physcomitrella patens	65.2	66	6e-22
Pp3c17_20880V3.2.p	Physcomitrella patens	65.2	66	8e-22
Pp3c17_20870V3.1.p	Physcomitrella patens	65.2	66	1e-21
Pp3c17_20880V3.1.p	Physcomitrella patens	65.2	66	1e-21

Showing 1 to 10 of 85 entries

Protein sequence

QENLSNKLIEVDKNIIRPCNGQLLSLKVIKVFLRKNKKLRCWKQALQKLKRRRGLDGDENNNNYRI