Pp3c18_4570V3.1.p (PRGDB2110123)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110123	Pp3c18_4570V3.1.p	N	putative	NBS, TM	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c17_18950V3.1.p	Physcomitrella patens	88.9	63	4e-31
Pp3c17_18950V3.2.p	Physcomitrella patens	88.9	63	4e-31
Pp3c21_6260V3.1.p	Physcomitrella patens	68.2	63	2e-23
Pp3c13_19900V3.1.p	Physcomitrella patens	73	63	3e-23
Pp3s203_50V3.1.p	Physcomitrella patens	86.8	53	3e-22
Pp3c17_20880V3.2.p	Physcomitrella patens	66.7	63	2e-21
Pp3c21_11820V3.2.p	Physcomitrella patens	69.8	53	2e-21
Pp3c21_15570V3.1.p	Physcomitrella patens	66.7	63	3e-21
Pp3c17_20870V3.1.p	Physcomitrella patens	66.7	63	4e-21
Pp3c17_20880V3.1.p	Physcomitrella patens	66.7	63	4e-21

Showing 1 to 10 of 88 entries

Protein sequence

MKLFIIHSCSQENLPNKLIEVDKNIIRLYNGLLLSLKVIKVFLKKNKKLRCWEQALQKLKTRR