Pp3c17_18950V3.1.p (PRGDB2110122)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110122	Pp3c17_18950V3.1.p	N	putative	NBS	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c17_18950V3.2.p	Physcomitrella patens	99.9	76	3e-48
Pp3s203_50V3.1.p	Physcomitrella patens	87.9	66	3e-34
Pp3c13_19900V3.1.p	Physcomitrella patens	75	76	8e-33
Pp3c21_6260V3.1.p	Physcomitrella patens	69.7	76	5e-32
Pp3c18_4570V3.1.p	Physcomitrella patens	88.9	63	5e-31
Pp3c17_20880V3.2.p	Physcomitrella patens	68.4	76	1e-29
Pp3c13_15200V3.2.p	Physcomitrella patens	69.7	76	3e-29
Pp3c21_15570V3.1.p	Physcomitrella patens	68.4	76	3e-29
Pp3c17_20870V3.1.p	Physcomitrella patens	68.4	76	4e-29
Pp3c17_20880V3.1.p	Physcomitrella patens	68.4	76	4e-29

Showing 1 to 10 of 96 entries

Protein sequence

MKLFIIHSCSQENFPNKLIEVDKNIIRPCNSLLLSLKVIKVFLRKHKKLRCWEQALQKLKRRRALDGDEN
NNNYKI