Pp3c17_21060V3.1.p (PRGDB2110125)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110125	Pp3c17_21060V3.1.p	CN	putative	CC, NBS	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c17_20940V3.1.p	Physcomitrella patens	97.6	41	9e-21
Pp3s203_50V3.1.p	Physcomitrella patens	97.6	41	2e-20
Pp3c17_18950V3.1.p	Physcomitrella patens	92.7	41	8e-20
Pp3c17_18950V3.2.p	Physcomitrella patens	92.7	41	8e-20
Pp3c13_19900V3.1.p	Physcomitrella patens	80.5	41	1e-15
Pp3c18_4530V3.1.p	Physcomitrella patens	75.6	41	6e-15
Pp3c21_15570V3.1.p	Physcomitrella patens	73.2	41	4e-14
Pp3c13_15270V3.1.p	Physcomitrella patens	73.2	41	5e-14
Pp3c13_15270V3.2.p	Physcomitrella patens	73.2	41	6e-14
Pp3c18_4530V3.2.p	Physcomitrella patens	75.6	41	2e-13

Showing 1 to 10 of 68 entries

Protein sequence

LKVIKVFLRKNKKLRCWEQALQKLKRRRGLDGDENNNNYRI