Potri.006G269600.1 (PRGDB2113407)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113407	Potri.006G269600.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.011G014100.2	Populus trichocarpa	93.1	72	7e-43
Potri.011G014100.1	Populus trichocarpa	93.1	72	7e-43
Potri.T039200.1	Populus trichocarpa	88.9	72	3e-41
Potri.011G014900.1	Populus trichocarpa	84	81	2e-40
Potri.T069500.1	Populus trichocarpa	93.1	72	5e-40
Potri.T067500.1	Populus trichocarpa	94.4	72	7e-40
Potri.011G013900.1	Populus trichocarpa	93.1	72	1e-39
Potri.011G013400.1	Populus trichocarpa	94.4	72	2e-39
Potri.011G013700.1	Populus trichocarpa	93.1	72	2e-39
Potri.011G013700.2	Populus trichocarpa	93.1	72	2e-39

Showing 1 to 10 of 499 entries

Protein sequence

MTDKRHQRRESEDCRSLKSLIFARIGMAAGKYQESYSSRFSNCKYQVFLSLRGADTRKNFTDHLYKALVD
VGFHTFRDDDEIRRGKNIRLELQKAIKQ