Potri.T039200.1 (PRGDB2113406)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113406	Potri.T039200.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.011G014100.2	Populus trichocarpa	93.1	72	1e-42
Potri.011G014100.1	Populus trichocarpa	93.1	72	1e-42
Potri.006G269600.1	Populus trichocarpa	88.9	72	2e-41
Potri.T039600.1	Populus trichocarpa	88.9	72	2e-40
Potri.T069500.1	Populus trichocarpa	93.1	72	9e-40
Potri.T038500.1	Populus trichocarpa	86.1	72	1e-39
Potri.011G060600.1	Populus trichocarpa	93.1	72	3e-39
Potri.001G363400.1	Populus trichocarpa	90.3	72	4e-39
Potri.T068600.1	Populus trichocarpa	91.7	72	5e-39
Potri.011G015400.2	Populus trichocarpa	84.7	72	6e-39

Showing 1 to 10 of 499 entries

Protein sequence

MAAGKYQESYSSRFSNCKHQVFLSFRGADTRKNFTDHLYKALVDAGIHTFRDDDEIRIGENIELELQKAI
QQ