Potri.T039600.1 (PRGDB2113413)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113413	Potri.T039600.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.001G363400.1	Populus trichocarpa	97	166	2e-110
Potri.T039900.1	Populus trichocarpa	95.2	166	1e-109
Potri.T112200.1	Populus trichocarpa	94.6	166	4e-106
Potri.011G008700.1	Populus trichocarpa	94	166	4e-104
Potri.T039100.1	Populus trichocarpa	94	166	3e-103
Potri.T069200.2	Populus trichocarpa	91	166	9e-103
Potri.T069200.1	Populus trichocarpa	91	166	9e-103
Potri.011G014100.2	Populus trichocarpa	85.5	166	1e-102
Potri.011G014100.1	Populus trichocarpa	85.5	166	1e-102
Potri.T040100.1	Populus trichocarpa	85.5	166	4e-102

Showing 1 to 10 of 499 entries

Protein sequence

MAAGKYQESYSSRFSNCKYQVFLSFRGPDTRKNFTDHLYKALIQAGIHTFRDVDEIRRGENIDFELQKAI
QQSKISIIVFSKDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVGRQTGSFAAAFMEHEKHFNE
EKERVSGWRIALKEVADLAGMVLGDG