Potri.T040100.1 (PRGDB2113420)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113420	Potri.T040100.1	T	putative	TM, TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.011G009400.1	Populus trichocarpa	97.6	166	3e-114
Potri.T037600.1	Populus trichocarpa	98.2	166	6e-112
Potri.T037900.1	Populus trichocarpa	96.4	166	3e-110
Potri.011G014100.2	Populus trichocarpa	85.5	166	4e-102
Potri.011G014100.1	Populus trichocarpa	85.5	166	4e-102
Potri.T039600.1	Populus trichocarpa	85.5	166	4e-102
Potri.011G015400.2	Populus trichocarpa	84.3	166	2e-100
Potri.T039900.1	Populus trichocarpa	86.1	166	3e-97
Potri.T069200.2	Populus trichocarpa	85.5	166	3e-97
Potri.T069200.1	Populus trichocarpa	85.5	166	3e-97

Showing 1 to 10 of 499 entries

Protein sequence

MAAAKYQASSSSRFSHCKYRVFLSFRGEDTRKNFTDHLYTALVQAGIHTFRDDDEIGRGENIESELQKAI
QQSKIAIIVFSKDYASSRWCLDEIVMIMERRRTADCRVLPVFYDVDPSQVRKQTGSFAAAFVEHEKHFKE
EMERVNGWRIALKEVADLAGMVLGDG