Potri.011G008500.1 (PRGDB2113423)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113423	Potri.011G008500.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.011G014100.2	Populus trichocarpa	84.3	83	2e-46
Potri.011G014100.1	Populus trichocarpa	84.3	83	2e-46
Potri.011G015400.2	Populus trichocarpa	85.5	83	8e-45
Potri.011G060600.1	Populus trichocarpa	85.5	83	3e-44
Potri.006G270000.1	Populus trichocarpa	85.5	83	2e-43
Potri.011G013400.1	Populus trichocarpa	84.3	83	2e-43
Potri.T067500.1	Populus trichocarpa	84.3	83	4e-43
Potri.011G013700.1	Populus trichocarpa	83.1	83	7e-43
Potri.011G013700.2	Populus trichocarpa	83.1	83	7e-43
Potri.011G013700.3	Populus trichocarpa	83.1	83	7e-43

Showing 1 to 10 of 499 entries

Protein sequence

YAWSRWFLDELVKIMERKRTTGSIVLPVFYHVDPSEVKNQTGSFAAAFVEQEKRFKEEMERVNGWRIALK
EVSELAGMDLGDG