Potri.011G015400.2 (PRGDB2113417)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113417	Potri.011G015400.2	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.011G015400.1	Populus trichocarpa	99.9	166	6e-111
Potri.011G014100.2	Populus trichocarpa	85.5	166	1e-102
Potri.011G014100.1	Populus trichocarpa	85.5	166	1e-102
Potri.T040100.1	Populus trichocarpa	84.3	166	2e-100
Potri.T039600.1	Populus trichocarpa	84.3	166	3e-100
Potri.011G012000.1	Populus trichocarpa	88	166	1e-96
Potri.T039900.1	Populus trichocarpa	85.5	166	2e-96
SapurV1A.7304s0010.1.p	Salix purpurea	78.9	166	2e-96
Potri.T069500.1	Populus trichocarpa	84.9	166	3e-96
Potri.T069200.2	Populus trichocarpa	85.5	166	6e-96

Showing 1 to 10 of 499 entries

Protein sequence

MAAGKYKESYSSRFPNCKYQVFLSFRGEDTRKNFTDHLYTTLVQAGIHTFRDDNEIRRGENIDFELQKAI
QQSKISIIVFSKNYACSRWCLDELVMIMERRRTTSSIVFPVFYDVLPSEVRNQTGSFAAAFVEQEKRFKE
EMERVNGWRIALKEVADLAGMVLGDG