Prupe.2G113300.1.p (PRGDB2117966)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117966	Prupe.2G113300.1.p	T	putative	TM, TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.2G113200.1.p	Prunus persica	99.9	63	2e-38
Prupe.8G044400.1.p	Prunus persica	90.5	63	1e-32
Prupe.2G112700.1.p	Prunus persica	99.9	50	2e-31
Prupe.8G044300.4.p	Prunus persica	87.3	63	4e-30
Prupe.8G044300.3.p	Prunus persica	87.3	63	4e-30
Prupe.8G044300.2.p	Prunus persica	87.3	63	4e-30
Prupe.8G044300.1.p	Prunus persica	87.3	63	4e-30
Prupe.8G041000.1.p	Prunus persica	90.5	63	6e-30
Prupe.6G160100.1.p	Prunus persica	84.1	63	1e-26
Prupe.8G032000.1.p	Prunus persica	82.5	63	3e-26

Showing 1 to 10 of 499 entries

Protein sequence

MPSTPLSFQISISIFVIFQAIYDQLSALIFEYLISEVLVSLSSIYSRSSRFPMALSTQRASAFLPSADQS
APPQWNYDVFLSFRGVDTRNSFLSHLYHELQHRCIKTFMDDPKLESVSLQPKPPE