Bostr.29223s0148.1.p (PRGDB212941)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212941	Bostr.29223s0148.1.p	T	putative	TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.7993s0003.1.p	Conradina grandiflora	72.1	111	2e-43
Cagra.21829s0001.1.p	Conradina grandiflora	65.5	113	5e-42
875511	Arabidopsis lyrata	66.7	111	6e-39
AT1G63870.1	Arabidopsis thaliana	82.7	81	2e-37
AT1G63860.1	Arabidopsis thaliana	72.5	98	4e-36
AT1G63860.2	Arabidopsis thaliana	72.5	98	4e-36
Bo9g029470.1	Brassica oleracea	75.6	78	2e-35
AT1G63880.1	Arabidopsis thaliana	62.5	112	3e-35
Araha.12875s0001.1.p	Arabidopsis halleri	62	108	5e-35
Bo9g029510.1	Brassica oleracea	56.6	106	6e-35

Showing 1 to 10 of 499 entries

Protein sequence

MSTMASPSSFPPQNYKFNVFPSFHGPDVRKTLLSHMRKQLNSNGITMFDDQGIERSEEIAPSLKKAIRES
RISIVIISKKYLDKKAISEEKSSSSSSWEKKKLMLLNCNKGKSKAKKELNNLM