Cagra.1531s0001.1.p (PRGDB225301)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225301	Cagra.1531s0001.1.p	T	putative	TIR	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.8169s0028.1.p	Babiana stricta	79.8	158	5e-84
Bostr.30057s0091.2.p	Babiana stricta	80.7	155	1e-83
Bostr.30057s0091.3.p	Babiana stricta	80.7	155	1e-83
Bo9g029510.1	Brassica oleracea	77.7	157	3e-83
Araha.3236s0003.1.p	Arabidopsis halleri	80	155	2e-82
Bostr.30057s0091.1.p	Babiana stricta	80.7	155	3e-82
Araha.25586s0003.1.p	Arabidopsis halleri	79	148	6e-82
AT2G16870.1	Arabidopsis thaliana	79.3	155	9e-82
480565	Arabidopsis lyrata	80	155	7e-81
875523	Arabidopsis lyrata	80	155	1e-80

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSPRTWRYRVFMSFHGPDVRKTFVSHLRKQFFCNSITMFDDQGIQRSQIIAAALTEAIRDSRISIV
VLSQNYASSSWCLDELLEILKFKEDIGQIVMTVFYGVDPSDVRKQTGEFGKVFDTTCAYRTEEERQNWSH
ALNYVGNIAGEHLLN