Araha.25586s0003.1.p (PRGDB28335)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28335	Araha.25586s0003.1.p	T	putative	TIR	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bo9g029510.1	Brassica oleracea	80	160	2e-89
Bostr.8169s0028.1.p	Babiana stricta	79.9	159	1e-86
Araha.3236s0003.1.p	Arabidopsis halleri	81.1	159	1e-84
Cagra.1531s0001.1.p	Conradina grandiflora	78.6	154	3e-84
875509	Arabidopsis lyrata	83.9	149	6e-84
Araha.0550s0005.1.p	Arabidopsis halleri	83	159	2e-83
Cagra.7993s0004.1.p	Conradina grandiflora	83.2	149	2e-83
AT1G63730.1	Arabidopsis thaliana	83.3	156	3e-83
480565	Arabidopsis lyrata	81.1	159	4e-83
875523	Arabidopsis lyrata	81.9	155	8e-83

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSSSSFRTWRHRVFASFHGPDVRKTFLSHLRKQFNYHGITMFNDQGIERSQTIALELTRAIRESRI
SIVVFSKNYASSSWCLDELLEILKCKEDIGQVVMTVFYGVDPSDVRKQTGEFGSVFNETCAPKTKEDRTK
WSQALNDVGNIAGEQFLNWFVLN