Carubv10018802m (PRGDB220283)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220283	Carubv10018802m	T	putative	TIR	Capsella rubella

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.28243s0030.1.p	Babiana stricta	71	183	4e-87
Cagra.2161s0001.1.p	Conradina grandiflora	69.4	196	3e-85
Bostr.28243s0034.1.p	Babiana stricta	67.2	195	1e-84
Carubv10018868m	Capsella rubella	69.5	190	5e-83
Bostr.0556s0150.1.p	Babiana stricta	68.2	179	2e-80
Bostr.0556s0151.1.p	Babiana stricta	59.6	213	4e-78
Araha.49972s0001.1.p	Arabidopsis halleri	61.2	201	1e-76
Bostr.11774s0003.1.p	Babiana stricta	59.1	213	2e-76
Carubv10018622m	Capsella rubella	69.3	163	2e-75
Carubv10019041m	Capsella rubella	62.8	188	2e-75

Showing 1 to 10 of 499 entries

Protein sequence

MRNAVSPFNVHQVFLNFRGEELRYNFVSHLTDAFERQGIKFFIDKNEQRGEDLKHIFVRIKESRIALAIF
SPSYAESKWCMDELVMMNNLADHGKLRVIPIFYKVDADDVRKPTLDSEFGRNFQKLAEDFSKHQVKKWKK
ALKRICDKMGLPLEEKSSESDFVDEIVKGVKKLEDAIGLEEEEKPFSREKIKRKARNLNKRLRRYI